Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR031W  from Saccharomyces cerevisiae S288C
>YDR031W|YDR031W MIC14 SGDID:S000002438, Chr IV from 503498-503863, Genome Release 64-1-1, Verified ORF, "Mitochondrial intermembrane space protein, required for normal oxygen consumption; contains twin cysteine-x9-cysteine motifs" ORGANISM: Saccharomyces cerevisiae S288C (121 aa)
MSDILDEIVIEDVVANCPQEFLQYHKCIRDNEENPGKCKDGRMILSTCIREKVPSVKSIM
SECSEPMKKYDQCIRDNMGTRTINENCLGFLQDLRKCAELQVKNKNIKPSINGVNLELIK
D