Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR025W  from Saccharomyces cerevisiae S288C
>YDR025W|YDR025W RPS11A SGDID:S000002432, Chr IV from 491515-491559,491899-492324, Genome Release 64-1-1, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps11Bp and has similarity to E. coli S17 and rat S11 ribosomal proteins" ORGANISM: Saccharomyces cerevisiae S288C (156 aa)
MSTELTVQSERAFQKQPHIFNNPKVKTSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPF
TGLVSIRGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFRVQVG
DIVTVGQCRPISKTVRFNVVKVSAAAGKANKQFAKF