Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR020C  from Saccharomyces cerevisiae S288C
>YDR020C|YDR020C DAS2 SGDID:S000002427, Chr IV from 486444-485746, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; non-essential gene identified in a screen for mutants with increased levels of rDNA transcription; weak similarity with uridine kinases and with phosphoribokinases" ORGANISM: Saccharomyces cerevisiae S288C (232 aa)
MDRKAVEEKRIVISIGGGHATGVGAIALDLQNTFKSLYNSINIRVINLDNMIEGNIKSYN
NNDYDFDNILNLVYEKHAVTSQNDMIQHDYEDPIDLIIVCGCYALYDKRINEISQLKVFL
DSDADKRLISLIKKKNVGSNEQLAQLITEYMDHLRPEMQQYIEPTRTFADLIIPSTNENL
GRAVLVDGIVKAIEDTKSQIEGNNTNNKIRPRLWDFEAETMDLEKDRYYDLS