Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR014W-A  from Saccharomyces cerevisiae S288C
>YDR014W-A|YDR014W-A HED1 SGDID:S000113613, Chr IV from 477797-478285, Genome Release 64-1-1, Verified ORF, "Meiosis-specific protein that down-regulates Rad51p-mediated mitotic recombination when the meiotic recombination machinery is impaired; early meiotic gene, transcribed specifically during meiotic prophase" ORGANISM: Saccharomyces cerevisiae S288C (162 aa)
MQQRSNRRSCSYIPLGVHNNAEKSLCTEVAPARKNKRSITTSPIVNINVVERRLFNLELE
KQQLRAKNLSENTGGGSPNGGAYLDAKKGVREQDQYQGGPSKELDRLQPPPSMKKSPPRK
KKSLKDLIYETNKTFYQVDSNKVKYKVGLSKKQLLPSKTVDN