Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR007W  from Saccharomyces cerevisiae S288C
>YDR007W|YDR007W TRP1 SGDID:S000002414, Chr IV from 461842-462516, Genome Release 64-1-1, Verified ORF, "Phosphoribosylanthranilate isomerase that catalyzes the third step in tryptophan biosynthesis; in 2004, the sequence of TRP1 from strain S228C was updated by changing the previously annotated internal STOP (TAA) to serine (TCA)" ORGANISM: Saccharomyces cerevisiae S288C (224 aa)
MSVINFTGSSGPLVKVCGLQSTEAAECALDSDADLLGIICVPNRKRTIDPVIARKISSLV
KAYKNSSGTPKYLVGVFRNQPKEDVLALVNDYGIDIVQLHGDESWQEYQEFLGLPVIKRL
VFPKDCNILLSAASQKPHSFIPLFDSEAGGTGELLDWNSISDWVGRQESPESLHFMLAGG
LTPENVGDALRLNGVIGVDVSGGVETNGVKDSNKIANFVKNAKK