Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YDR003W-A  from Saccharomyces cerevisiae S288C
>YDR003W-A|YDR003W-A YDR003W-A SGDID:S000028819, Chr IV from 454782-454904, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; identified by expression profiling and mass spectrometry" ORGANISM: Saccharomyces cerevisiae S288C (40 aa)
MTCGIENSYKSAEKKKKYRSFRFFESRDYSELCIIVGTYY