Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDR003W  from Saccharomyces cerevisiae S288C
>YDR003W|YDR003W RCR2 SGDID:S000002410, Chr IV from 454122-454754, Genome Release 64-1-1, Verified ORF, "Vacuolar protein that presumably functions within the endosomal-vacuolar trafficking pathway, affecting events that determine whether plasma membrane proteins are degraded or routed to the plasma membrane; similar to Rcr1p" ORGANISM: Saccharomyces cerevisiae S288C (210 aa)
MILREQIDFLIHKRQDDNNNNGEAITDDDPFSSSSWRWGRWIFFIFFIVALLILLFSTAK
VNRRRRIMGQAPIRGTAWLTPPTYRQSERDYNGTQRCVEDYVPEYTETANENDLGFYDER
GEFHPNGKTEYLAPPPLSEEQASSTDKDLQRPVAAVVRIPSESEFDFNLLRPTMNNFVNG
QSNRNEQHSPTVESSSFDVNNAPARAKVSK