Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YDL241W  from Saccharomyces cerevisiae S288C
>YDL241W|YDL241W YDL241W SGDID:S000002400, Chr IV from 20635-21006, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; YDL241W is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (123 aa)
MNVTENALLFKCGSKGYINQTYTPTEIYNCGVAEGKKTAKEKNPTYSIFYDTFLTGQPAE
SPETFTCGSHGFTNASYVASDFYACGFLQGKGTETNAGIHNTRPSHSLAKFTILFMLVLY
TIV