Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL235C  from Saccharomyces cerevisiae S288C
>YDL235C|YDL235C YPD1 SGDID:S000002394, Chr IV from 33918-33415, Genome Release 64-1-1, reverse complement, Verified ORF, "Phosphorelay intermediate protein, phosphorylated by the plasma membrane sensor Sln1p in response to osmotic stress and then in turn phosphorylates the response regulators Ssk1p in the cytosol and Skn7p in the nucleus" ORGANISM: Saccharomyces cerevisiae S288C (167 aa)
MSTIPSEIINWTILNEIISMDDDDSDFSKGLIIQFIDQAQTTFAQMQRQLDGEKNLTELD
NLGHFLKGSSAALGLQRIAWVCERIQNLGRKMEHFFPNKTELVNTLSDKSIINGINIDED
DEEIKIQVDDKDENSIYLILIAKALNQSRLEFKLARIELSKYYNTNL