Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL232W  from Saccharomyces cerevisiae S288C
>YDL232W|YDL232W OST4 SGDID:S000002391, Chr IV from 38487-38597, Genome Release 64-1-1, Verified ORF, "Subunit of the oligosaccharyltransferase complex of the ER lumen, which catalyzes protein asparagine-linked glycosylation; type I membrane protein required for incorporation of Ost3p or Ost6p into the OST complex" ORGANISM: Saccharomyces cerevisiae S288C (36 aa)
MISDEQLNSLAITFGIVMMTLIVIYHAVDSTMSPKN