Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL219W  from Saccharomyces cerevisiae S288C
>YDL219W|YDL219W DTD1 SGDID:S000002378, Chr IV from 65242-65306,65378-65765, Genome Release 64-1-1, Verified ORF, "D-Tyr-tRNA(Tyr) deacylase, functions in protein translation, may affect nonsense suppression via alteration of the protein synthesis machinery; ubiquitous among eukaryotes" ORGANISM: Saccharomyces cerevisiae S288C (150 aa)
MKIVLQKVSQASVVVDSKVISSIKHGYMLLVGISIDDSMAEIDKLSKKVLSLRIFEDESR
NLWKKNIKEANGEILSVSQFTLMAKTKKGTKPDFHLAQKGHIAKELYEEFLKLLRSDLGE
EKVKDGEFGAMMSCSLTNEGPVTIILDSDQ