Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL213C  from Saccharomyces cerevisiae S288C
>YDL213C|YDL213C NOP6 SGDID:S000002372, Chr IV from 77966-77289, Genome Release 64-1-1, reverse complement, Verified ORF, "rRNA-binding protein required for 40S ribosomal subunit biogenesis; contains an RNA recognition motif (RRM) and has similarity to hydrophilins; NOP6 may be a fungal-specific gene as no homologs have been yet identified in higher eukaryotes" ORGANISM: Saccharomyces cerevisiae S288C (225 aa)
MGSEEDKKLTKKQLKAQQFRKSKEEKDQEKDVKKEQAPEGKRPNSAAGNDGEEPVKKKRK
TRRGRGGKGKNGKKGNRFIVFVGSLPRDITAVELQNHFKNSSPDQIRLRADKGIAFLEFD
ADKDRTGIQRRMDIALLQHGTLLKEKKINVELTVGGGGNSQERLEKLKNKNIKLDEERKE
RLTKMINDGNQKKIAKTTATAAQTSGTDNKPVPAGIHPDRAKLLK