Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL177C  from Saccharomyces cerevisiae S288C
>YDL177C|YDL177C YDL177C SGDID:S000002336, Chr IV from 141721-141209, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; similar to the mouse IMPACT gene; YDL177C is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (170 aa)
MSKNVGKLVKIWNESEVLVDRKSKFQARCCPLQNQKDIPSILQELTQNNKSVSKASHMHM
YAWRTAEVSNNLHLQQEQKKKGNKANKSNNSHVNKSRNITVQPKNIEQGCADCGEAGAGQ
RLLTLLERANIFNVLVIVTRWYGGTPLGSSRFRHISTCAVETLKKGGFLP