Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL166C  from Saccharomyces cerevisiae S288C
>YDL166C|YDL166C FAP7 SGDID:S000002325, Chr IV from 164042-163449, Genome Release 64-1-1, reverse complement, Verified ORF, "Essential NTPase required for small ribosome subunit synthesis, mediates processing of the 20S pre-rRNA at site D in the cytoplasm but associates only transiently with 43S preribosomes via Rps14p, may be the endonuclease for site D" ORGANISM: Saccharomyces cerevisiae S288C (197 aa)
MEARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKDNDCFEGYDEGRKSHI
VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK
IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT
NEYQGPRSDDEDDEDSE