Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL160C-A  from Saccharomyces cerevisiae S288C
>YDL160C-A|YDL160C-A YDL160C-A SGDID:S000028520, Chr IV from 169608-169366, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; mutant in a srs2 mutant background displays MMS hypersensitivity; ortholog of human MHF2, a component of the Fanconi anemia (FA) complex that is involved in maintaining genome stability" ORGANISM: Saccharomyces cerevisiae S288C (80 aa)
MLSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKS
PLELSHQDLERIVGLLLMDM