Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YDL159W-A  from Saccharomyces cerevisiae S288C
>YDL159W-A|YDL159W-A YDL159W-A SGDID:S000007599, Chr IV from 172182-172313, Genome Release 64-1-1, Uncharacterized ORF, "Putative protein of unknown function; identified by sequence comparison with hemiascomycetous yeast species" ORGANISM: Saccharomyces cerevisiae S288C (43 aa)
MYNQIINTFIDDCLFLQTPMLQSPISSKIVLSFFLRNFFPSLF