Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL157C  from Saccharomyces cerevisiae S288C
>YDL157C|YDL157C YDL157C SGDID:S000002316, Chr IV from 174588-174232, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies" ORGANISM: Saccharomyces cerevisiae S288C (118 aa)
MSNILAVFNPPPQRELEKEETMDCVPCQVMSTMFSVGFGSYLASGKPFKYGKKEAKRGIS
LTEFEKRNPQWWKVTLRSFGGLLIAFGFVRGTEGWLWHKNKEYKNYKKLSNDGETQAN