Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL139C  from Saccharomyces cerevisiae S288C
>YDL139C|YDL139C SCM3 SGDID:S000002298, Chr IV from 212046-211375, Genome Release 64-1-1, reverse complement, Verified ORF, "Nonhistone component of centromeric chromatin that binds stoichiometrically to CenH3-H4 histones, required for kinetochore assembly; required for G2/M progression and localization of Cse4p; may protect Cse4p from ubiquitylation" ORGANISM: Saccharomyces cerevisiae S288C (223 aa)
MKTNKKISKRRSLKNLHGALKGLLKESGKKSESKIRKHSDCNPVHRVYPPNIEKRKTKKD
DGISRPIAERNGHVYIMSKENHIIPKLTDDEVMERHKLADENMRKVWSNIISKYESIEEQ
GDLVDLKTGEIVEDNGHIKTLTANNSTKDKRTKYTSVLRDIIDISDEEDGDKNDEYTLWA
NDSEASDSEVDADNDTEEEKDEKLIDADFKKYEAKLSKRILRD