Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL136W  from Saccharomyces cerevisiae S288C
>YDL136W|YDL136W RPL35B SGDID:S000002295, Chr IV from 217600-217602,218008-218367, Genome Release 64-1-1, Verified ORF, "Protein component of the large (60S) ribosomal subunit, identical to Rpl35Ap and has similarity to rat L35 ribosomal protein" ORGANISM: Saccharomyces cerevisiae S288C (120 aa)
MAGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKSIACVLTVINE
QQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVTEKQRKKQIAFPQRKYAIKA