Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL130W-A  from Saccharomyces cerevisiae S288C
>YDL130W-A|YDL130W-A STF1 SGDID:S000007232, Chr IV from 229171-229431, Genome Release 64-1-1, Verified ORF, "Protein involved in regulation of the mitochondrial F1F0-ATP synthase; Stf1p and Stf2p may act as stabilizing factors that enhance inhibitory action of the Inh1p protein" ORGANISM: Saccharomyces cerevisiae S288C (86 aa)
MLNRCISRNTRLPVNLRIASRFYSDGPLGGAGPGNPQDIFIKRERAKEDYYARQQEREQL
AHVKEQLKEHKKKLENLENKINNLSK