Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL130W  from Saccharomyces cerevisiae S288C
>YDL130W|YDL130W RPP1B SGDID:S000002288, Chr IV from 229906-230019,230321-230527, Genome Release 64-1-1, Verified ORF, "Ribosomal protein P1 beta, component of the ribosomal stalk, which is involved in interaction of translational elongation factors with ribosome; accumulation is regulated by phosphorylation and interaction with the P2 stalk component" ORGANISM: Saccharomyces cerevisiae S288C (106 aa)
MSDSIISFAAFILADAGLEITSDNLLTITKAAGANVDNVWADVYAKALEGKDLKEILSGF
HNAGPVAGAGAASGAAAAGGDAAAEEEKEEEAAEESDDDMGFGLFD