Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL125C  from Saccharomyces cerevisiae S288C
>YDL125C|YDL125C HNT1 SGDID:S000002283, Chr IV from 239398-239019,239606-239510, Genome Release 64-1-1, reverse complement, Verified ORF, "Adenosine 5'-monophosphoramidase; interacts physically and genetically with Kin28p, a CDK and TFIIK subunit, and genetically with CAK1; member of the histidine triad (HIT) superfamily of nucleotide-binding proteins and similar to Hint" ORGANISM: Saccharomyces cerevisiae S288C (158 aa)
MEPLISAPYLTTTKMSAPATLDAACIFCKIIKSEIPSFKLIETKYSYAFLDIQPTAEGHA
LIIPKYHGAKLHDIPDEFLTDAMPIAKRLAKAMKLDTYNVLQNNGKIAHQEVDHVHFHLI
PKRDEKSGLIVGWPAQETDFDKLGKLHKELLAKLEGSD