Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL123W  from Saccharomyces cerevisiae S288C
>YDL123W|YDL123W SNA4 SGDID:S000002281, Chr IV from 241418-241840, Genome Release 64-1-1, Verified ORF, "Protein of unknown function, localized to the vacuolar outer membrane; predicted to be palmitoylated" ORGANISM: Saccharomyces cerevisiae S288C (140 aa)
MCCYCVCCTVSDFILYIVAFFFPPAAVLLRSGPCSSDFLLNVLLTLLGFLPGMLHAFYYI
TITSPLRNAEYVYYYQQGWVDSERNVPSNRPQNSQTPQNRPQQGSSARNVYPSVETPLLQ
GAAPHDNKQSLVESPPPYVP