Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL121C  from Saccharomyces cerevisiae S288C
>YDL121C|YDL121C YDL121C SGDID:S000002279, Chr IV from 245582-245133, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the endoplasmic reticulum; YDL121C is not an essential protein" ORGANISM: Saccharomyces cerevisiae S288C (149 aa)
MNLYGYFLLLIIVIAFIALLPLFSGIGTFKLTKPKSSATAQSATGKLGKREYLKKKLDHT
NVLKFDLKDTEESLGHDSASASSASRKFEIDSKTGLKRRVIGQYNKDPNDFDFDIDDLIN
EDELDERREEEKKLKKYNGKKNEAYEGFV