Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL120W  from Saccharomyces cerevisiae S288C
>YDL120W|YDL120W YFH1 SGDID:S000002278, Chr IV from 245923-246447, Genome Release 64-1-1, Verified ORF, "Mitochondrial matrix iron chaperone; oxidizes and stores iron; interacts with Isu1p to promote Fe-S cluster assembly; mutation results in multiple Fe/S-dependent enzyme deficiencies; human frataxin homolog is mutated in Friedrich's ataxia" ORGANISM: Saccharomyces cerevisiae S288C (174 aa)
MIKRSLASLVRVSSVMGRRYMIAAAGGERARFCPAVTNKKNHTVNTFQKRFVESSTDGQV
VPQEVLNLPLEKYHEEADDYLDHLLDSLEELSEAHPDCIPDVELSHGVMTLEIPAFGTYV
INKQPPNKQIWLASPLSGPNRFDLLNGEWVSLRNGTKLTDILTEEVEKAISKSQ