Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL118W  from Saccharomyces cerevisiae S288C
>YDL118W|YDL118W YDL118W SGDID:S000002276, Chr IV from 247302-247682, Genome Release 64-1-1, Uncharacterized ORF, "Non-essential protein of unconfirmed function; mutants are defective in telomere maintenance, and are synthetically sick or lethal with alpha-synuclein" ORGANISM: Saccharomyces cerevisiae S288C (126 aa)
MFESFVNEGTAFLLFAKDERIRFKHDKYKALPIDVRNAEGNVPLHSCRGLSISFKFFHNV
AFLSCWILVFKRSKGCNATADVSPPKKPPIKCDEFLGLVACSVMYAASQIVYLLVVPAVL
FAFLLV