Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL110C  from Saccharomyces cerevisiae S288C
>YDL110C|YDL110C TMA17 SGDID:S000002268, Chr IV from 264964-264512, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein of unknown function that associates with ribosomes; heterozygous deletion demonstrated increases in chromosome instability in a rad9 deletion background; protein abundance is decreased upon intracellular iron depletion" ORGANISM: Saccharomyces cerevisiae S288C (150 aa)
MCSAGGIRRPIQIEEFKTAISGMSDMELAQIKTEIENSINHLQRSNARLGKYIAKLEGAD
DRLEADDSDDLENIDSGDLALYKDSVRENEIVLNNYNERVDALEQETVYRKTGHGKSKHE
VEAKDNTNKGPDVDMDNSNVDVVTPNSIFI