Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL092W  from Saccharomyces cerevisiae S288C
>YDL092W|YDL092W SRP14 SGDID:S000002250, Chr IV from 292781-293221, Genome Release 64-1-1, Verified ORF, "Signal recognition particle (SRP) subunit, interacts with the RNA component of SRP to form the Alu domain, which is the region of SRP responsible for arrest of nascent chain elongation during membrane targeting; homolog of mammalian SRP14" ORGANISM: Saccharomyces cerevisiae S288C (146 aa)
MANTGCLSPGAFLSKVPEFFQTANEKHITVRLTAKRLIEHDPVEGNLEFDSTNHPDYDVS
KKASEISVSSRSDREYPLLIRMSYGSHDKKTKCSTVVKASELDQFWQEYSSVFKGGMQNL
IKKKKKKSKNGTISKTGKKNKVAKKN