Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL083C  from Saccharomyces cerevisiae S288C
>YDL083C|YDL083C RPS16B SGDID:S000002241, Chr IV from 307333-306926,307789-307766, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; identical to Rps16Ap and has similarity to E. coli S9 and rat S16 ribosomal proteins" ORGANISM: Saccharomyces cerevisiae S288C (143 aa)
MSAVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPLLLVGLDKF
SNIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSKNELKKAFTSYDRTLLIAD
SRRPEPKKFGGKGARSRFQKSYR