>YDL081C|YDL081C RPP1A SGDID:S000002239, Chr IV from 310122-309802, Genome Release 64-1-1, reverse complement, Verified ORF, "Ribosomal stalk protein P1 alpha, involved in the interaction between translational elongation factors and the ribosome; accumulation of P1 in the cytoplasm is regulated by phosphorylation and interaction with the P2 stalk component" ORGANISM: Saccharomyces cerevisiae S288C (106 aa)
MSTESALSYAALILADSEIEISSEKLLTLTNAANVPVENIWADIFAKALDGQNLKDLLVN
FSAGAAAPAGVAGGVAGGEAGEAEAEKEEEEAKEESDDDMGFGLFD