Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL075W  from Saccharomyces cerevisiae S288C
>YDL075W|YDL075W RPL31A SGDID:S000002233, Chr IV from 322226-322282,322704-322988, Genome Release 64-1-1, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl31Bp and has similarity to rat L31 ribosomal protein; associates with the karyopherin Sxm1p; loss of both Rpl31p and Rpl39p confers lethality" ORGANISM: Saccharomyces cerevisiae S288C (113 aa)
MAGLKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVRLAPELNQAIW
KRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVASAKGLQTVVVEEDA