Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL067C  from Saccharomyces cerevisiae S288C
>YDL067C|YDL067C COX9 SGDID:S000002225, Chr IV from 334396-334217, Genome Release 64-1-1, reverse complement, Verified ORF, "Subunit VIIa of cytochrome c oxidase, which is the terminal member of the mitochondrial inner membrane electron transport chain" ORGANISM: Saccharomyces cerevisiae S288C (59 aa)
MTIAPITGTIKRRVIMDIVLGFSLGGVMASYWWWGFHMDKINKREKFYAELAERKKQEN