Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL012C  from Saccharomyces cerevisiae S288C
>YDL012C|YDL012C YDL012C SGDID:S000002170, Chr IV from 431386-431108,431517-431473, Genome Release 64-1-1, reverse complement, Verified ORF, "Tail-anchored plasma membrane protein containing a conserved CYSTM module, possibly involved in response to stress; may contribute to non-homologous end-joining (NHEJ) based on ydl012c htz1 double null phenotype" ORGANISM: Saccharomyces cerevisiae S288C (107 aa)
MSAQDYYGNSASKQSYSRPSAPPPGYETASRGYAPSQSQQNYYPPQQQQQQYQQQPQYYQ
QQQPQYYQQHPQQPIYVQQQPASSGNEDCLAGCLAGLCLCCTLDMLF