Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL010W  from Saccharomyces cerevisiae S288C
>YDL010W|YDL010W GRX6 SGDID:S000002168, Chr IV from 432330-433025, Genome Release 64-1-1, Verified ORF, "Cis-golgi localized monothiol glutaredoxin that binds an iron-sulfur cluster; more similar in activity to dithiol than other monothiol glutaredoxins; involved in the oxidative stress response; functional overlap with GRX7" ORGANISM: Saccharomyces cerevisiae S288C (231 aa)
MIPSNKRNARILSITTLLLLLVFFVAQNANFLTVEIKEETSKAFSTNMDNMAGGSSREYA
AMPTSTTNKGSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITKAFNVQKEYS
LILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGR
GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSNN