Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL008W  from Saccharomyces cerevisiae S288C
>YDL008W|YDL008W APC11 SGDID:S000002166, Chr IV from 433497-433994, Genome Release 64-1-1, Verified ORF, "Catalytic core subunit of the Anaphase-Promoting Complex/Cyclosome (APC/C), which is a ubiquitin-protein ligase required for degradation of anaphase inhibitors, including mitotic cyclins, during the metaphase/anaphase transition; contains a RING-H2 domain that is required for activity" ORGANISM: Saccharomyces cerevisiae S288C (165 aa)
MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD
QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR
RREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR