Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YDL007C-A  from Saccharomyces cerevisiae S288C
>YDL007C-A|YDL007C-A YDL007C-A SGDID:S000113557, Chr IV from 436824-436567, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function" ORGANISM: Saccharomyces cerevisiae S288C (85 aa)
MFLPIIFHTILTLLNFGKYYCLPIQEDDDKSGKEIEQILDNNIESLGLLLNSMSLSSNFT
TGDPELDSLFQDDLIPELYSVLDGF