Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL004W  from Saccharomyces cerevisiae S288C
>YDL004W|YDL004W ATP16 SGDID:S000002162, Chr IV from 443029-443511, Genome Release 64-1-1, Verified ORF, "Delta subunit of the central stalk of mitochondrial F1F0 ATP synthase, which is a large, evolutionarily conserved enzyme complex required for ATP synthesis; phosphorylated" ORGANISM: Saccharomyces cerevisiae S288C (160 aa)
MLRSIIGKSASRSLNFVAKRSYAEAAAASSGLKLQFALPHETLYSGSEVTQVNLPAKSGR
IGVLANHVPTVEQLLPGVVEVMEGSNSKKFFISGGFATVQPDSQLCVTAIEAFPLESFSQ
ENIKNLLAEAKKNVSSSDAREAAEAAIQVEVLENLQSVLK