Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YDL002C  from Saccharomyces cerevisiae S288C
>YDL002C|YDL002C NHP10 SGDID:S000002160, Chr IV from 447578-446967, Genome Release 64-1-1, reverse complement, Verified ORF, "Protein related to mammalian high mobility group proteins; preferentially binds DNA ends, protecting them from exonucleatic cleavage; likely component of the chromatin-remodeling complex INO80 complex; proposed to be involved in DNA repair" ORGANISM: Saccharomyces cerevisiae S288C (203 aa)
MSVEEKKRRLEELKDQNVVLGLAIQRSRLSVKRLKLEYGVLLERLESRIELDPELNCEDP
LPTLASFKQELLTKPFRKSKTKRHKVKERDPNMPKRPTNAYLLYCEMNKERIRQNGSLDV
TRDLAEGWKNLNEQDRKPYYKLYSEDRERYQMEMEIYNKKISNIDADDDKEENEQKIKNN
EEGSSTKVADSKGGEDGSLVSSN