Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YCR108C  from Saccharomyces cerevisiae S288C
>YCR108C|YCR108C YCR108C SGDID:S000028536, Chr III from 316188-315997, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by fungal homology and RT-PCR" ORGANISM: Saccharomyces cerevisiae S288C (63 aa)
MPYSPSLILMGHTHTDATVYTTLKLPYSHTPIHGPFSLNQYQMHPHHYARHLPQRSIPCA
IYP