Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YCR087C-A  from Saccharomyces cerevisiae S288C
>YCR087C-A|YCR087C-A YCR087C-A SGDID:S000007223, Chr III from 264467-264006, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the nucleolus; YCR087C-A is not an essential gene" ORGANISM: Saccharomyces cerevisiae S288C (153 aa)
MVTFNCEVCNDTVPKKNTEKHYYRCPNAYYTCIDCSKTFEDGVSYKNHTSCISEDEKYQK
ALYKGNKKQKQKQQQKQQQKQHQHQPVATPAKKVEKPVIKKAEKVEKTSNGIELHKGKSL
YKILKTMKDKGAKKTFLKSLVVDSEGQIRYAKE