Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YCR086W  from Saccharomyces cerevisiae S288C
>YCR086W|YCR086W CSM1 SGDID:S000000682, Chr III from 263392-263964, Genome Release 64-1-1, Verified ORF, "Nucleolar protein that forms a complex with Lrs4p and then Mam1p at kinetochores during meiosis I to mediate accurate homolog segregation; required for condensin recruitment to the replication fork barrier site and rDNA repeat segregation" ORGANISM: Saccharomyces cerevisiae S288C (190 aa)
MDPLTVYKNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKEL
KTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHSGGSSDDYSIMDYKL
GFVKGQAQVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSLN
KKREKKDETE