Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YCR083W  from Saccharomyces cerevisiae S288C
>YCR083W|YCR083W TRX3 SGDID:S000000679, Chr III from 259578-259961, Genome Release 64-1-1, Verified ORF, "Mitochondrial thioredoxin, highly conserved oxidoreductase required to maintain the redox homeostasis of the cell, forms the mitochondrial thioredoxin system with Trr2p, redox state is maintained by both Trr2p and Glr1p" ORGANISM: Saccharomyces cerevisiae S288C (127 aa)
MLFYKPVMRMAVRPLKSIRFQSSYTSITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKM
MQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTAL
EKGIKDL