Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YCR082W  from Saccharomyces cerevisiae S288C
>YCR082W|YCR082W AHC2 SGDID:S000000678, Chr III from 258883-259269, Genome Release 64-1-1, Verified ORF, "Component of the ADA histone acetyltransferase complex; Ach2p and Ach1p are unique to the ADA complex and not shared with the related SAGA and SLIK complexes; may tether Ach1p to the complex" ORGANISM: Saccharomyces cerevisiae S288C (128 aa)
MITPKGTHDAVAKFQKTDLHQDLDYIVLQQRRTQLETLINERESFVKNLCSLFHKIQNTK
NYQEFVDVLAENRDLLREIFTVENGFQKQKWISNDDIPQIDWDKFALDINAYIAENDQLL
ALYEDGLL