Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YCR063W  from Saccharomyces cerevisiae S288C
>YCR063W|YCR063W BUD31 SGDID:S000000659, Chr III from 228318-228791, Genome Release 64-1-1, Verified ORF, "Component of the SF3b subcomplex of the U2 snRNP; diploid mutants display a random budding pattern instead of the wild-type bipolar pattern" ORGANISM: Saccharomyces cerevisiae S288C (157 aa)
MPRIKTRRSKPAPDGFEKIKPTLTDFEIQLRDAQKDKSSKLAAKSNEQLWEIMQLHHQRS
RYIYTLYYKRKAISKDLYDWLIKEKYADKLLIAKWRKTGYEKLCCLRCIQKNETNNGSTC
ICRVPRAQLEEEARKKGTQVSFHQCVHCGCRGCASTD