Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YCR050C  from Saccharomyces cerevisiae S288C
>YCR050C|YCR050C YCR050C SGDID:S000000646, Chr III from 213772-213464, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Non-essential protein of unknown function; deletion mutant is synthetically sick or lethal with alpha-synuclein" ORGANISM: Saccharomyces cerevisiae S288C (102 aa)
MVAVHKVRYNVIMILGPEQTPNEKTTLDNCGLARRNLVLLKAVHTNCDSWNMNRYPLTLL
KMANMAISWNTALKKKVNNVAWLLLKCNAPMELWYTCLSKNL