Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YCR046C  from Saccharomyces cerevisiae S288C
>YCR046C|YCR046C IMG1 SGDID:S000000642, Chr III from 210423-209914, Genome Release 64-1-1, reverse complement, Verified ORF, "Mitochondrial ribosomal protein of the large subunit, required for respiration and for maintenance of the mitochondrial genome" ORGANISM: Saccharomyces cerevisiae S288C (169 aa)
MWSRNVRLLGSWTRSYMVPATKRKTIPVYPPVQRIASSQIMKQVALSEIESLDPGAVKRK
LISKKNKDRLKAGDVVRIVYDSSKCSYDTFVGYILSIDRKQLVQDASLLLRNQIAKTAVE
IRVPLFSPLIERIDLLTPHVSSRQRNKHYYIRGTRLDVGDLEAGLRRKK