Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List

Protein sequence for locus YCR024C-B  from Saccharomyces cerevisiae S288C
>YCR024C-B|YCR024C-B YCR024C-B SGDID:S000028818, Chr III from 162865-162599, Genome Release 64-1-1, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; identified by expression profiling and mass spectrometry" ORGANISM: Saccharomyces cerevisiae S288C (88 aa)
MCVCAIPFFEFFLPFIPHYAFLLFVSSVRFTVNERCYYLVCVLKLNCAFFFMVMIFELKR
VCVSYLDRSRKIQIVSFFPFITIIFFHS