Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YCR024C-A  from Saccharomyces cerevisiae S288C
>YCR024C-A|YCR024C-A PMP1 SGDID:S000000619, Chr III from 163067-162945, Genome Release 64-1-1, reverse complement, Verified ORF, "Small single-membrane span proteolipid that functions as a regulatory subunit of the plasma membrane H(+)-ATPase Pma1p, forms unique helix and positively charged cytoplasmic domain that is able to specifically segregate phosphatidylserines" ORGANISM: Saccharomyces cerevisiae S288C (40 aa)
MTLPGGVILVFILVGLACIAIIATIIYRKWQARQRGLQRF