Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YCR020W-B  from Saccharomyces cerevisiae S288C
>YCR020W-B|YCR020W-B HTL1 SGDID:S000006439, Chr III from 155320-155556, Genome Release 64-1-1, Verified ORF, "Component of the RSC chromatin remodeling complex; RSC functions in transcriptional regulation and elongation, chromosome stability, and establishing sister chromatid cohesion; involved in telomere maintenance" ORGANISM: Saccharomyces cerevisiae S288C (78 aa)
MSQNNTISSMNPERAYNNVTLKNLTAFQLLSQRENICELLNLVESTERHNSIINPERQRM
SLEEMKKMLDALKNERKK