Fungal Genome Collection
University of Nebraska Lincoln
School of Biological Sciences and Center for Plant Science Innovation
Home About FGC Use Cases Species List


Protein sequence for locus YCR020C-A  from Saccharomyces cerevisiae S288C
>YCR020C-A|YCR020C-A MAK31 SGDID:S000000614, Chr III from 155096-154830, Genome Release 64-1-1, reverse complement, Verified ORF, "Non-catalytic subunit of N-terminal acetyltransferase of the NatC type; required for replication of dsRNA virus; member of the Sm protein family" ORGANISM: Saccharomyces cerevisiae S288C (88 aa)
MDILKLSDFIGNTLIVSLTEDRILVGSLVAVDAQMNLLLDHVEERMGSSSRMMGLVSVPR
RSVKTIMIDKPVLQELTANKVELMANIV